PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.Y8IAI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 373aa    MW: 41648.6 Da    PI: 6.739
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.Y8IAIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-1954101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
      Aradu.Y8IAI  54 KGPWTPEEDKILVDYIQRHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 101
                      79********************************************97 PP

2Myb_DNA-binding56.28e-18107152148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++l++++++ lG++ W++Ia++++ gRt++++k++w+++l
      Aradu.Y8IAI 107 RGKFSDEEEQLIINLHAVLGNK-WAAIASHLP-GRTDNEIKNFWNTHL 152
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3749101IPR017930Myb domain
SuperFamilySSF466891.12E-3151148IPR009057Homeodomain-like
SMARTSM007173.0E-1553103IPR001005SANT/Myb domain
PfamPF002491.0E-1754101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2555108IPR009057Homeodomain-like
CDDcd001671.22E-1156101No hitNo description
PROSITE profilePS5129427.545102156IPR017930Myb domain
SMARTSM007171.3E-17106154IPR001005SANT/Myb domain
PfamPF002491.0E-16107152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-27109156IPR009057Homeodomain-like
CDDcd001678.44E-13109152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
EREETINNLA CLVNLQVLPT ITIYNFLSST TTSLTLIKVM MGRTGSSDES GLKKGPWTPE  60
EDKILVDYIQ RHGHGSWRAL PKLAGLNRCG KSCRLRWTNY LRPDIKRGKF SDEEEQLIIN  120
LHAVLGNKWA AIASHLPGRT DNEIKNFWNT HLKKKLLQMG LDPMTHRPRT DHLNLLTNLQ  180
HILAAANIVT TFTNPNHQIN TALTLQNMLQ PMPPAPSNLL NNLGSSLSLP DTLLYEGLGL  240
NVNDHSTLHN IIYNASNSAA SSSQNQFQNF DQQQMMMTMM NGSRNNNNSS NCSESQNFDE  300
QFGSTNATTT TTVTPSSSLP NLVSVSASPE RSSSSPTKNN NNNNNINSNS TFEIWGDFMD  360
VDPNDAYWKD FIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30521565108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150438e-78AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964712.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A151SD711e-133A0A151SD71_CAJCA; Transcription factor MYB39
STRINGGLYMA01G44370.21e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-84myb domain protein 9